Opened 18 years ago
Closed 17 years ago
#139 closed defect (wontfix)
genbank_multi.ift
| Reported by: | guest | Owned by: | devel |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | no idea | Version: | release_20071207 |
| Keywords: | import filter | Cc: |
Description
I've met a problem when I tried to import the following gb file into arb. Only if I remove the part of "sig_peptide" before "ORIGIN" it works fine. Maybe it's a new field in Genbank and it's needed to update the import filter?
Best, Yan
LOCUS NC_010511 759 bp DNA linear BCT 29-JUL-2008
DEFINITION Methylobacterium sp. 4-46, complete genome.
ACCESSION NC_010511 REGION: 637214..637972
VERSION NC_010511.1 GI:170738367
PROJECT GenomeProject:18809
KEYWORDS .
SOURCE Methylobacterium sp. 4-46
ORGANISM Methylobacterium sp. 4-46
Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
Methylobacteriaceae; Methylobacterium.
REFERENCE 1 (bases 1 to 759)
AUTHORS Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E.,
Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T.,
Detter,J.C., Han,C., Kuske,C.R., Schmutz,J., Larimer,F., Land,M.,
Hauser,L., Kyrpides,N., Ivanova,N., Marx,C.J. and Richardson,P.
CONSRTM US DOE Joint Genome Institute
TITLE Complete sequence of chromosome of Methylobacterium sp. 4-46
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 759)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2008) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 759)
AUTHORS Copeland,A., Lucas,S., Lapidus,A., Glavina del Rio,T., Dalin,E.,
Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T.,
Detter,J.C., Han,C., Kuske,C.R., Schmutz,J., Larimer,F., Land,M.,
Hauser,L., Kyrpides,N., Ivanova,N., Marx,C.J. and Richardson,P.
CONSRTM US DOE Joint Genome Institute
TITLE Direct Submission
JOURNAL Submitted (12-FEB-2008) US DOE Joint Genome Institute, 2800
Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from CP000943.
URL -- http://www.jgi.doe.gov
JGI Project ID: 4003784
Source DNA and bacteria available from Christopher J. Marx
(cmarx@oeb.harvard.edu)
Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
Paul Richardson (microbes@cuba.jgi-psf.org)
Quality assurance done by JGI-Stanford
Annotation done by JGI-ORNL and JGI-PGF
Finishing done by JGI-LANL
Finished microbial genomes have been curated to close all gaps with
greater than 98% coverage of at least two independent clones. Each
base pair has a minimum q (quality) value of 30 and the total error
rate is less than one per 50000.
The JGI and collaborators endorse the principles for the
distribution and use of large scale sequencing data adopted by the
larger genome sequencing community and urge users of this data to
follow them. it is our intention to publish the work of this
project in a timely fashion and we welcome collaborative
interaction on the project and analysis.
(http://www.genome.gov/page.cfm?pageID=10506376).
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..759
/organism="Methylobacterium sp. 4-46"
/mol_type="genomic DNA"
/strain="4-46"
/db_xref="taxon:426117"
gene complement(1..759)
/locus_tag="M446_0537"
/db_xref="GeneID:6135235"
CDS complement(1..759)
/locus_tag="M446_0537"
/note="PFAM: rhodopsin;
KEGG: rxy:Rxyl_2037 rhodopsin"
/codon_start=1
/transl_table=11
/product="rhodopsin"
/protein_id="YP_001767533.1"
/db_xref="GI:170738878"
/db_xref="InterPro:IPR000425"
/db_xref="InterPro:IPR001425"
/db_xref="GeneID:6135235"
/translation="MTVQTWLWLTLFAMSLGAAAILFTAKRRTPEEETDGILHGIVPL
IAAASYLAMACGQGAIRLPLGADPAAQWDFYFARYIDWTFTTPILLYALATDAMHSGM
RRHGAVFGMLAADVLMIATALFFGASATAWIKWTWYAVSCGAFLGVYYVIWVPLLEES
RREREDVRAAFRRNAAFLSVVWLIYPLVLIVGTDGLKLVSPVLTTALIAVLDVVAKVV
FGLMAVGERARIVDRDLHETRPVRRSAPSLAPAE"
sig_peptide complement(697..759)
/locus_tag="M446_0537"
/note="Signal predicted by SignalP 3.0 HMM (Signal peptide
probability 0.944) with cleavage site probability 0.699 at
residue 21"
ORIGIN
1 ctactcggcc ggcgcgaggc tcggcgcgga gcgccggacg ggccgggtct cgtggaggtc
61 gcggtccacg atcctcgccc gctcgccgac cgccatgaga ccgaacacca ccttggcgac
121 gacgtcgagg acggcgatca gcgccgtggt gaggaccggg ctcacgagct tcagcccgtc
181 ggtcccgacg atgagcacga gggggtagat gagccagacc accgacagga aggccgcgtt
241 gcgccggaac gcggcccgca cgtcctcgcg ctccctgcga ctctcctcga gcagcggcac
301 ccagatcacg tagtagacgc cgagaaaggc gccgcaggag acggcgtacc aggtccactt
361 gatccacgcc gtcgccgagg cgccgaagaa cagggcggtc gcgatcatca gcacgtcggc
421 ggcgagcatg ccgaacacgg cgccgtgccg gcgcatgccg gaatgcatcg cgtccgtcgc
481 gagggcgtag agcaggatgg gggtggtgaa ggtccagtcg atgtagcgcg cgaagtagaa
541 gtcccactgc gccgcgggat ccgccccgag cggaagccgg atcgcgccct gaccgcacgc
601 catcgccagg tacgacgcgg ccgcgatgag ggggacgatc ccgtgcagga tgccgtccgt
661 ctcctcttcc ggagttcggc gcttggctgt gaagagaatg gccgctgcgc cgagggacat
721 cgcgaacagg gtcaaccaca gccaagtctg cacggtcat
//
Change History (2)
comment:1 Changed 17 years ago by eissler
comment:2 Changed 17 years ago by meierh
- Resolution set to wontfix
- Status changed from new to closed
the import works in principle using svn-version 6016 on OpenSuSE 11.1_64, although not all information is imported.
But I think, genbank_multi.ift is the wrong filter for this file. genbank_multi was made for importing flatfiles containing multiple genbank entries (with one Feature
mainly CDS each) in order to produce multiple ARBDB-entries.
For this file the correct import routine would be "Import genome data"! (Or a very special "import filter would have to be coded").

the import of this file works using svn-version 5962 on Ubuntu 9.04 (32 and 64 bit)
maybe already fixed by [5937] ?